Document And Entity Information September 2023 Share Repurchase Program [Member] Relating to the September 2023 Share Repurchase Program. hstm_IncomeTaxExpenseBenefitMerger Income Tax Expense (Benefit), Merger Represents merger effects on income tax expense (benefit). Note To Financial Statement Details Textual Note 2 - Revenue Recognition and Sales Commissions Note 4 - Shareholders' Equity Debt Securities, Available-for-Sale [Table Text Block] Note 5 - Earnings Per Share Note 6 - Marketable Securities Note 2 - Revenue Recognition and Sales Commissions - Revenues Disaggregated By Revenue Source (Details) Note 4 - Shareholders' Equity - Dividend Policy (Details) Note 4 - Shareholders' Equity - Summary of Stock-based Compensation Expense (Details) Note 5 - Earnings Per Share - Computation of Basic and Diluted Earnings Per Share (Details) Note 6 - Marketable Securities - Fair Value of Available for Sale Marketable Securities (Details) Income Tax Disclosure [Text Block] Notes To Financial Statements Unrealized gain (loss) on marketable securities Notes To Financial Statements [Abstract] Third Quarter Dividends [Member] Relating to third quarter dividends. Stock-based compensation us-gaap_ShareBasedCompensation Other assets Electronic Education Documentation System, LLC [Member] Represents Electronic Education Documentation System, LLC. us-gaap_LiabilitiesCurrent Total current liabilities us-gaap_BusinessCombinationConsiderationTransferred1 Business Combination, Consideration Transferred us-gaap_FiniteLivedIntangibleAssetsPurchaseAccountingAdjustments Finite-Lived Intangible Assets, Purchase Accounting Adjustments us-gaap_OtherThanTemporaryImpairmentLossDebtSecuritiesAvailableForSale Other-than-temporary Impairment Loss, Debt Securities, Available-for-sale, Total us-gaap_ShareBasedCompensationArrangementByShareBasedPaymentAwardEquityInstrumentsOtherThanOptionsGrantsInPeriodWeightedAverageGrantDateFairValue Share-Based Compensation Arrangement by Share-Based Payment Award, Equity Instruments Other than Options, Grants in Period, Weighted Average Grant Date Fair Value (in dollars per share) Foreign currency translation adjustments US Treasury Securities [Member] us-gaap_ShareBasedCompensationArrangementByShareBasedPaymentAwardEquityInstrumentsOtherThanOptionsGrantsInPeriod Share-Based Compensation Arrangement by Share-Based Payment Award, Equity Instruments Other than Options, Grants in Period (in shares) Proceeds from maturities of marketable securities Depreciation and amortization Depreciation and amortization Other comprehensive loss, net of taxes: us-gaap_AssetsCurrent Total current assets hstm_StockRepurchasedAccruedExpense Stock Repurchased, Accrued Expense The amount of accrued expense payable from stock repurchases. Equity [Text Block] Third Amendment [Member] Represents information regarding the Third Amendment to the credit agreement. Amended and Restated Revolving Credit Agreement [Member] Relating to the Amended and Restated Revolving Credit Agreement. us-gaap_PaymentsToAcquireMarketableSecurities Purchases of marketable securities Common stock, shares outstanding (in shares) Financial Instruments [Domain] hstm_LineOfCreditFacilityPercentageOfApplicableMarginForBorrowings Line of Credit Facility, Percentage of Applicable Margin for Borrowings Represents the applicable margin percentage for borrowings under a line of credit facility. Adjustments to reconcile net income to net cash provided by operating activities: Common stock, shares authorized (in shares) Truist Bank [Member] Represents information regarding Truist Bank. Swing Line Subfacility [Member] Represents information regarding a swing line subfacility. Common stock, shares issued (in shares) Letter of Credit Subfacility [Member] Represents information regarding a letter of credit subfacility. Deferred revenue hstm_LineOfCreditFacilityIncreasedFacilitySizeDueToAccordionFeature Line of Credit Facility, Increased Facility Size Due to Accordion Feature Represents the increased line of credit facility size due to accordion feature. Financial Instrument [Axis] Common stock, par value (in dollars per share) hstm_DebtInstrumentCovenantMaximumFundedDebtLeverageRatio Debt Instrument, Covenant, Maximum Funded Debt Leverage Ratio Requirement for maximum funded debt ratio (consolidated debt/consolidated EBITDA) under the debt agreement. Accrued expenses Common stock, no par value, 75,000 shares authorized; 30,590 and 30,579 shares issued and outstanding at September 30, 2023 and December 31, 2022, respectively hstm_DebtInstrumentCovenantInterestCoverageRatio Debt Instrument, Covenant, Interest Coverage Ratio Represents the minimum requirement for interest coverage ratio under the debt agreement. Statistical Measurement [Domain] Maximum [Member] Minimum [Member] Accounts payable Revolving Credit Facility [Member] Product and Service [Axis] Other prepaid expenses and other current assets Product and Service [Domain] Statistical Measurement [Axis] Credit Facility [Axis] Proceeds from sale of fixed assets Credit Facility [Domain] us-gaap_PolicyTextBlockAbstract Accounting Policies Prepaid royalties, net of amortization Trade Names [Member] Other Intangible Assets [Member] us-gaap_PaymentsForSoftware Payments associated with capitalized software development Accrued royalties us-gaap_PaymentsToAcquirePropertyPlantAndEquipment Purchases of property and equipment Effect of dilutive shares (in shares) Fair Value Hierarchy and NAV [Domain] Fair Value, Inputs, Level 2 [Member] us-gaap_ShareBasedCompensationArrangementByShareBasedPaymentAwardAwardVestingPeriod1 Share-Based Compensation Arrangement by Share-Based Payment Award, Award Vesting Period (Year) Weighted average shares of common stock outstanding: Noncompete Agreements [Member] Fair Value Hierarchy and NAV [Axis] Current liabilities: Vesting [Axis] Developed Technology Rights [Member] Vesting [Domain] us-gaap_Assets Total assets Accounts receivable - unbilled OPERATING ACTIVITIES: Customer Relationships [Member] Customer-Related Intangible Assets [Member] Statement [Line Items] Accounts Receivable, Allowance for Credit Loss, Current Accounts receivable, net of allowance for doubtful accounts of $710 and $544 at September 30, 2023 and December 31, 2022, respectively Deferred tax assets Finite-Lived Intangible Assets by Major Class [Axis] Finite-Lived Intangible Assets, Major Class Name [Domain] Share-Based Payment Arrangement, Expensed and Capitalized, Amount [Table Text Block] AOCI Attributable to Parent [Member] Shareholders’ equity: Marketable securities Other income, net Business Description and Basis of Presentation [Text Block] Award Type [Domain] Current assets: Award Type [Axis] Net income Net income Net income Accumulated amortization on intangible assets us-gaap_CashCashEquivalentsRestrictedCashAndRestrictedCashEquivalentsIncludingDisposalGroupAndDiscontinuedOperations Cash and cash equivalents at beginning of period Cash and cash equivalents at end of period Intangible Assets, Net Restricted Stock Units (RSUs) [Member] us-gaap_CashCashEquivalentsRestrictedCashAndRestrictedCashEquivalentsPeriodIncreaseDecreaseIncludingExchangeRateEffect Net (decrease) increase in cash and cash equivalents us-gaap_NetCashProvidedByUsedInFinancingActivities Net cash used in financing activities Two Thousand Twenty Three Performance [Member] Represents performance measures based on 2023 performance. Effect of exchange rate changes on cash and cash equivalents us-gaap_OperatingIncomeLoss Operating income us-gaap_ContractWithCustomerLiabilityRevenueRecognized Contract with Customer, Liability, Revenue Recognized us-gaap_NetCashProvidedByUsedInOperatingActivities Net cash provided by operating activities us-gaap_NetCashProvidedByUsedInInvestingActivities Net cash used in investing activities us-gaap_GoodwillPurchaseAccountingAdjustments Goodwill, Purchase Accounting Adjustments Base Rate [Member] Not Based on 2023 Performance [Member] Related to not based on 2023 performance. Deferred tax liabilities Accumulated amortization on property and equipment Business Combination Disclosure [Text Block] Property and equipment, net of accumulated depreciation of $23,441 and $20,280 at September 30, 2023 and December 31, 2022, respectively Goodwill Long-Term Debt, Type [Axis] Long-Term Debt, Type [Domain] us-gaap_PaymentsRelatedToTaxWithholdingForShareBasedCompensation Taxes paid related to net settlement of equity awards hstm_ReserveForUncertainTaxPosition Reserve for Uncertain Tax Position Represents reserve for uncertain tax position. hstm_IncomeTaxExpenseBenefitStateAppointmentChange Income Tax Expense (Benefit), State Appointment Change Represents state appointment charge for income tax expense (benefit). us-gaap_PaymentsOfDividendsCommonStock Payment of cash dividends hstm_IncomeTaxExpenseBenefitStockbasedAwards Income Tax Expense (Benefit), Stock-based Awards Represents stock-based awards for income tax expense (benefit). us-gaap_CostsAndExpenses Total operating costs and expenses hstm_IncomeTaxExpenseNonTaxableGain Income Tax Expense, Non Taxable Gain Represents non taxable gain for income tax expense. us-gaap_PaymentsForRepurchaseOfCommonStock Payments for Repurchase of Common Stock Repurchases of common stock INVESTING ACTIVITIES: Operating costs and expenses: us-gaap_AvailableForSaleSecuritiesDebtSecurities Fair Value Net income per share: Retained Earnings [Member] Earnings Per Share [Text Block] Revenues, net Revenues Non-marketable equity investments Accounts payable and accrued expenses us-gaap_IncreaseDecreaseInAccountsPayableAndAccruedLiabilities Common Stock Including Additional Paid in Capital [Member] Share Repurchase Program [Domain] us-gaap_StockRepurchaseProgramAuthorizedAmount1 Stock Repurchase Program, Authorized Amount Income tax provision Income Tax Expense (Benefit) Short-Term Debt, Type [Axis] Equity Components [Axis] Share Repurchase Program [Axis] Short-Term Debt, Type [Domain] Equity Component [Domain] us-gaap_RevenueRemainingPerformanceObligationPercentage Revenue, Remaining Performance Obligation, Percentage us-gaap_RevenueRemainingPerformanceObligationExpectedTimingOfSatisfactionPeriod1 Revenue, Remaining Performance Obligation, Expected Timing of Satisfaction, Period (Month) us-gaap_RevenueRemainingPerformanceObligation Revenue, Remaining Performance Obligation, Amount Revenue, Remaining Performance Obligation, Expected Timing of Satisfaction, Start Date [Axis] us-gaap_IncomeLossFromContinuingOperationsBeforeIncomeTaxesExtraordinaryItemsNoncontrollingInterest Income before income tax provision Accrued royalties us-gaap_IncreaseDecreaseInRoyaltiesPayable Other general and administrative expenses us-gaap_LineOfCredit Long-Term Line of Credit, Total Cash and cash equivalents Disaggregation of Revenue [Table Text Block] us-gaap_AllocatedShareBasedCompensationExpense Stock-based compensation expense Revenue from Contract with Customer [Text Block] Second Quarter Dividends [Member] Represents 2nd quarter dividends. First Quarter Dividends [Member] Represents 1st quarter dividends. Document Quarterly Report Amendment Flag Entity Incorporation, State or Country Code General and Administrative Expense [Member] Accounting Policies [Abstract] us-gaap_ComprehensiveIncomeNetOfTax Comprehensive income Document Transition Report City Area Code Entity Interactive Data Current Selling and Marketing Expense [Member] Dividends declared per share (in dollars per share) Common Stock, Dividends, Per Share, Declared (in dollars per share) hstm_EffectiveIncomeTaxRateReconciliationChangeInEstimatedTaxCreditsAmount Effective Income Tax Rate Reconciliation, Change in Estimated Tax Credits, Amount Amount of the difference between reported income tax expense (benefit) and expected income tax expense (benefit) computed by applying the domestic federal statutory income tax rates to pretax income (loss) from continuing operations, attributable to increase (decrease) in the estimated tax credits. Deferred revenue us-gaap_IncreaseDecreaseInContractWithCustomerLiability Security Exchange Name us-gaap_CommonStockSharesOutstanding Balance (in shares) Balance (in shares) Title of 12(b) Security us-gaap_IncreaseDecreaseInOtherOperatingAssets Other assets Current Fiscal Year End Date us-gaap_DebtInstrumentBasisSpreadOnVariableRate1 Debt Instrument, Basis Spread on Variable Rate Cost of Sales [Member] us-gaap_IncreaseDecreaseInPrepaidDeferredExpenseAndOtherAssets Other prepaid expenses and other current assets Document Fiscal Period Focus Document Fiscal Year Focus Document Period End Date Income Statement Location [Axis] Income Statement Location [Domain] Entity File Number us-gaap_DividendsCash Dividends, cash outlay Entity Emerging Growth Company hstm_EffectiveIncomeTaxRateReconciliationChangeInFairValueOfNoncontrollingInterestAmount Effective Income Tax Rate Reconciliation, Change in Fair Value of Noncontrolling Interest, Amount Amount of the difference between reported income tax expense (benefit) and expected income tax expense (benefit) computed by applying the domestic federal statutory income tax rates to pretax income (loss) from continuing operations attributable to change in fair value of noncontrolling interest. Document Type hstm_IncomeTaxExpenseBenefitDiscreteAdjustments Income Tax Expense (Benefit), Discrete Adjustments Amount of discrete adjustments to income tax expense (benefit) and deferred income tax expense (benefit) pertaining to continuing operations. Entity Small Business Entity Shell Company Document Information [Line Items] Document Information [Table] us-gaap_IncreaseDecreaseInPrepaidRoyalties Prepaid royalties Entity Filer Category Entity Current Reporting Status us-gaap_DividendsCommonStock Dividends declared on common stock ($0.025 per share) Accumulated amortization on capitalized software development Variable Rate [Domain] Capitalized software development, net of accumulated amortization of $121,235 and $105,025 at September 30, 2023 and December 31, 2022, respectively Fed Funds Effective Rate Overnight Index Swap Rate [Member] Accounts and unbilled receivables us-gaap_IncreaseDecreaseInReceivables Eurodollar [Member] us-gaap_AntidilutiveSecuritiesExcludedFromComputationOfEarningsPerShareAmount Antidilutive Securities Excluded from Computation of Earnings Per Share, Amount (in shares) Variable Rate [Axis] Diluted (in shares) Weighted-average diluted shares (in shares) Stock-based compensation Statement of Comprehensive Income [Abstract] Entity Tax Identification Number Entity Central Index Key Entity Registrant Name Entity [Domain] Legal Entity [Axis] Statement [Table] Entity Address, Address Line One Statement of Financial Position [Abstract] Diluted (in dollars per share) Basic (in shares) Weighted-average shares outstanding (in shares) hstm_ShareBasedCompensationArrangementByShareBasedPaymentAwardIncrementalPerformancePercentageYearThree Share Based Compensation Arrangement By Share Based Payment Award Incremental Performance Percentage Year Three Represents the incremental increase in performance percentage, year 3. Entity Address, City or Town hstm_ShareBasedCompensationArrangementByShareBasedPaymentAwardIncrementalPerformancePercentageYearFour Share Based Compensation Arrangement By Share Based Payment Award Incremental Performance Percentage Year Four Represents the incremental increase in performance percentage, year 4. Cost of revenues (excluding depreciation and amortization) Amortization of deferred commissions Amortization of Deferred Sales Commissions us-gaap_EffectiveIncomeTaxRateContinuingOperations Effective Income Tax Rate Reconciliation, Percent hstm_ShareBasedCompensationArrangementByShareBasedPaymentAwardIncrementalPerformancePercentageYearFive Share Based Compensation Arrangement By Share Based Payment Award Incremental Performance Percentage Year Five Represents the incremental increase in performance percentage, year 1. Entity Address, Postal Zip Code hstm_Sharebasedcompensationarrangementbysharebasedpaymentawardincrementalperformancepercentageyearone Share Based Compensation Arrangement By Share Based Payment Award Incremental Performance Percentage Year One represents the incremental increase in performance percentage, year 1. Business Acquisition [Axis] Basic (in dollars per share) Entity Address, State or Province Business Acquisition, Acquiree [Domain] hstm_Sharebasedcompensationarrangementbysharebasedpaymentawardincrementalperformancepercentageyeartwo Share Based Compensation Arrangement By Share Based Payment Award Incremental Performance Percentage Year Two represents the incremental increase in performance percentage, year 2. us-gaap_StockRepurchasedDuringPeriodShares Stock Repurchased During Period, Shares (in shares) Repurchase of common stock (in shares) Statement of Cash Flows [Abstract] Entity Common Stock, Shares Outstanding Performance Based Restricted Stock Units (RSUs) [Member] Represents the performance based restricted stock units. Statement of Stockholders' Equity [Abstract] Investments in Debt and Marketable Equity Securities (and Certain Trading Assets) Disclosure [Text Block] us-gaap_StockRepurchasedDuringPeriodValue Stock Repurchased During Period, Value Repurchase of common stock Income Statement [Abstract] Comprehensive income (loss) Total other comprehensive loss Trading Symbol Issuance of common stock in acquisition (in shares) Local Phone Number Issuance of common stock in acquisition us-gaap_GainLossOnDispositionOfAssets Gain on sale of fixed assets us-gaap_TableTextBlock Notes Tables us-gaap_LineOfCreditFacilityMaximumBorrowingCapacity Line of Credit Facility, Maximum Borrowing Capacity us-gaap_LineOfCreditFacilityUnusedCapacityCommitmentFeePercentage Line of Credit Facility, Unused Capacity, Commitment Fee Percentage Common stock issued under stock plans, net of shares withheld for employee taxes (in shares) Provision for credit losses Accounts Receivable, Credit Loss Expense (Reversal) Common stock issued under stock plans, net of shares withheld for employee taxes us-gaap_DividendPayableDateToBePaidDayMonthAndYear Dividends Payable, Date to be Paid Dividends Declared [Table Text Block] FINANCING ACTIVITIES: Sales and marketing Other long-term liabilities Line of Credit Facility, Lender [Domain] us-gaap_DividendsPayableDateDeclaredDayMonthAndYear Dividends, declaration date us-gaap_DividendsPayableDateOfRecordDayMonthAndYear Dividends Payable, Date of Record Secured Overnight Financing Rate (SOFR) Overnight Index Swap Rate [Member] us-gaap_DividendsPayableAmountPerShare Dividends, amount per share (in dollars per share) Deferred commissions Represents the amount associated with customer, asset, sales commission, noncurrent. Lender Name [Axis] us-gaap_LiabilitiesAndStockholdersEquity Total liabilities and shareholders’ equity hstm_StockRepurchasedAveragePricePerShare Stock Repurchased Average Price per Share (in dollars per share) Represents the stock repurchased average price per share. Dividends [Axis] Dividends [Domain] Product development Retained earnings Accumulated other comprehensive loss Debt Disclosure [Text Block] Changes in operating assets and liabilities: Deferred revenue, noncurrent us-gaap_StockholdersEquity Total shareholders’ equity Balance Balance us-gaap_PaymentsToAcquireBusinessesNetOfCashAcquired Business combinations, net of cash acquired Change in fair value of non-marketable equity investments Represents the change in fair value of non-marketable equity investments during the period. us-gaap_DisclosureTextBlockAbstract Notes to Financial Statements hstm_IncreaseDecreaseInDeferredCommissions Deferred commissions Represents the increase (decrease) in deferred commissions during the period. us-gaap_OtherNoncashIncomeExpense Other Subsequent Event [Member] Operating lease liability, noncurrent Class of Stock [Axis] hstm_GainLossOnNonMarketableEquityInvestments Loss on non-marketable equity investments Represents the amount of loss (gain) recognized during the period on non-marketable equity investments. Proceeds from sale of non-marketable equity investments Information on the proceeds from the sale of non-marketable equity investments. Schedule of Earnings Per Share, Basic and Diluted [Table Text Block] Subscription Services [Member] Represents information regarding subscription services. us-gaap_PaymentsToAcquireBusinessesGross Payments to Acquire Businesses, Gross Professional Services [Member] Represents information regarding professional services. Subsequent Event Type [Axis] Subsequent Event Type [Domain] Product Development [Member] Represents information included in the Product Development line item. us-gaap_AvailableForSaleDebtSecuritiesAccumulatedGrossUnrealizedLossBeforeTax Unrealized Losses Unrealized Gains Subsequent Events [Text Block] Operating lease right of use assets, net Deferred income taxes Adjusted Cost